Lineage for d4y28a_ (4y28 A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580221Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2580222Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2580223Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 protein domains)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2580230Protein automated matches [236561] (3 species)
    not a true protein
  7. 2580231Species Pea (Pisum sativum) [TaxId:3888] [276242] (4 PDB entries)
  8. 2580236Domain d4y28a_: 4y28 A: [276246]
    Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28c_, d4y28d_, d4y28e_, d4y28f_, d4y28j_
    automated match to d4kt0a_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y28a_

PDB Entry: 4y28 (more details), 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.
PDB Compounds: (A:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d4y28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y28a_ f.29.1.1 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
evkiildrdpiktsfeqwakpghfsrtiakgpdtttwiwnlhadahdfdshtsdleeisr
kvfsahfgqlsiiflwlsgmyfhgarfsnyeawlndpthirpsaqvvwpivgqeilngdv
gggfrgiqitsgffqiwrasgitselqlyctaigalvfaglmlfagwfhyhkaapklawf
qdvesmlnhhlagllglgslswaghqvhvslpinqflnagvdpkeiplphefilnrdlla
qlypsfaegatpfftlnwskyadfltfrggldpltgglwltdiahhhlaiailfliaghm
yrtnwgighgikdileahkgpftgqghkglyeilttswhaqlsinlamlgsltivvaqhm
ysmppypylatdyatqlslfthhmwiggflivgaaahaaifmvrdydpttryndlldrvl
rhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnth
alapgttapgatastsltwgggdlvavgnkvallpiplgtadflvhhihaftihvtvlil
lkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynsisvvifhf
swkmqsdvwgtindqgvvthittgnfaqssitingwlrdflwaqasqviqsygsslsayg
lfflgahfvwafslmflfsgrgywqeliesivwahnklkvapatqpralsivqgravgvt
hyllggiattwafflariiavg

SCOPe Domain Coordinates for d4y28a_:

Click to download the PDB-style file with coordinates for d4y28a_.
(The format of our PDB-style files is described here.)

Timeline for d4y28a_: