Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein automated matches [236563] (6 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276244] (8 PDB entries) |
Domain d4y28c_: 4y28 C: [276245] Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28a_, d4y28b_, d4y28d_, d4y28e_, d4y28f_, d4y28j_ automated match to d4kt0c_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex |
PDB Entry: 4y28 (more details), 2.8 Å
SCOPe Domain Sequences for d4y28c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y28c_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd flsvrvylwhettrsmglay
Timeline for d4y28c_: