Lineage for d4y28c_ (4y28 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2555964Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2556026Protein automated matches [236563] (6 species)
    not a true protein
  7. 2556036Species Pea (Pisum sativum) [TaxId:3888] [276244] (8 PDB entries)
  8. 2556043Domain d4y28c_: 4y28 C: [276245]
    Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28a_, d4y28b_, d4y28d_, d4y28e_, d4y28f_, d4y28j_
    automated match to d4kt0c_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y28c_

PDB Entry: 4y28 (more details), 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d4y28c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y28c_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

SCOPe Domain Coordinates for d4y28c_:

Click to download the PDB-style file with coordinates for d4y28c_.
(The format of our PDB-style files is described here.)

Timeline for d4y28c_: