![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily) core:11 transmembrane helices |
![]() | Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) ![]() automatically mapped to Pfam PF00223 |
![]() | Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins) Photosystem I p700 chlorophyll a apoprotein a1/a2 |
![]() | Protein automated matches [236561] (2 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276242] (4 PDB entries) |
![]() | Domain d4y28b_: 4y28 B: [276243] Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28c_, d4y28d_, d4y28e_, d4y28f_, d4y28j_ automated match to d1jb0b_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex |
PDB Entry: 4y28 (more details), 2.8 Å
SCOPe Domain Sequences for d4y28b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y28b_ f.29.1.1 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} alrlprfsqgiaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflwt sgnlfhvawqgnfeawvqdpfhvrpiahaiwdphfgqpaveaftrggalgpvniaysgvy qwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhlsg lfgvsslawaghlvhvaipgsrgeyvrwnnfldvlpypqglgplltgqwnlyaqnpsssn hlfgttqgagtailtilggfhpqtqslwltdmahhhlaiaflfligglmyrtnfgighsi kyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayafi aqdfttqaalythhqyiagfimtgafahgpiffirdynpeqnadnvlarmlehkeaiish lswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgktsygfdvllsst ngpalnagrniwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgalda rgsklmpdkkdfgysfpcdgpgrggtcdisawddfylavfwmlntigwvtfywhwkhitl wrgnvsqfnesstylmgwlrdylwlnssqlingytplvcnslsvwawmflfghlvwatgf mfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyifty aafliastsgkf
Timeline for d4y28b_: