Lineage for d4uymb1 (4uym B:50-518)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331680Species Aspergillus fumigatus [TaxId:746128] [276175] (3 PDB entries)
  8. 2331682Domain d4uymb1: 4uym B:50-518 [276241]
    Other proteins in same PDB: d4uyma2, d4uymb2
    automated match to d3k1oa_
    complexed with hem, vor

Details for d4uymb1

PDB Entry: 4uym (more details), 2.55 Å

PDB Description: crystal structure of sterol 14-alpha demethylase (cyp51b) from a pathogenic filamentous fungus aspergillus fumigatus in complex with voriconazole
PDB Compounds: (B:) 14-alpha sterol demethylase

SCOPe Domain Sequences for d4uymb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uymb1 a.104.1.0 (B:50-518) automated matches {Aspergillus fumigatus [TaxId: 746128]}
ktppvvfhwfpfigstisygidpykfffdcrakygdiftfillgkkttvylgtkgndfil
ngklrdvcaeevysplttpvfgrhvvydcpnaklmeqkkfvkygltsdalrsyvplitde
vesfvknspafqghkgvfdvcktiaeitiytasrslqgkevrskfdstfaelyhnldmgf
apinfmlpwaplphnrkrdaaqrkltetymeiikarrqagskkdsedmvwnlmscvykng
tpvpdeeiahmmiallmagqhsssstaswivlrlatrpdimeelyqeqirvlgsdlpplt
ydnlqkldlhakviketlrlhapihsiiravknpmavdgtsyviptshnvlsspgvtars
eehfpnplewnphrwdeniaasaeddekvdygyglvskgtnspylpfgagrhrcigeqfa
ylqlgtitavlvrlfrfrnlpgvdgipdtdysslfskplgrsfvefekr

SCOPe Domain Coordinates for d4uymb1:

Click to download the PDB-style file with coordinates for d4uymb1.
(The format of our PDB-style files is described here.)

Timeline for d4uymb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uymb2