Lineage for d1c9ub_ (1c9u B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17044Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies)
  4. 17133Superfamily b.68.2: Soluble quinoprotein glucose dehydrogenase [50952] (1 family) (S)
  5. 17134Family b.68.2.1: Soluble quinoprotein glucose dehydrogenase [50953] (1 protein)
  6. 17135Protein Soluble quinoprotein glucose dehydrogenase [50954] (1 species)
  7. 17136Species Acinetobacter calcoaceticus [TaxId:471] [50955] (4 PDB entries)
  8. 17144Domain d1c9ub_: 1c9u B: [27624]

Details for d1c9ub_

PDB Entry: 1c9u (more details), 2.2 Å

PDB Description: crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq

SCOP Domain Sequences for d1c9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ub_ b.68.2.1 (B:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
vltdtagnvqkddgsvtntlenpgslikftyk

SCOP Domain Coordinates for d1c9ub_:

Click to download the PDB-style file with coordinates for d1c9ub_.
(The format of our PDB-style files is described here.)

Timeline for d1c9ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c9ua_