Lineage for d1c9ub_ (1c9u B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.2: Soluble quinoprotein glucose dehydrogenase [50952] (1 family) (S)
  5. Family b.68.2.1: Soluble quinoprotein glucose dehydrogenase [50953] (2 proteins)
  6. Protein Soluble quinoprotein glucose dehydrogenase [50954] (1 species)
  7. Species Acinetobacter calcoaceticus [TaxId:471] [50955] (4 PDB entries)
  8. Domain d1c9ub_: 1c9u B: [27624]
    complexed with ca, gol, pqq

Details for d1c9ub_

PDB Entry: 1c9u (more details), 2.2 Å

PDB Description: crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq
PDB Compounds: (B:) soluble quinoprotein glucose dehydrogenase

SCOPe Domain Sequences for d1c9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ub_ b.68.2.1 (B:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
vltdtagnvqkddgsvtntlenpgslikftyk

SCOPe Domain Coordinates for d1c9ub_ are not available.

Timeline for d1c9ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c9ua_