Lineage for d1c9ua_ (1c9u A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62715Fold b.68: 6-bladed beta-propeller [50938] (6 superfamilies)
  4. 62816Superfamily b.68.2: Soluble quinoprotein glucose dehydrogenase [50952] (1 family) (S)
  5. 62817Family b.68.2.1: Soluble quinoprotein glucose dehydrogenase [50953] (1 protein)
  6. 62818Protein Soluble quinoprotein glucose dehydrogenase [50954] (1 species)
  7. 62819Species Acinetobacter calcoaceticus [TaxId:471] [50955] (4 PDB entries)
  8. 62826Domain d1c9ua_: 1c9u A: [27623]

Details for d1c9ua_

PDB Entry: 1c9u (more details), 2.2 Å

PDB Description: crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq

SCOP Domain Sequences for d1c9ua_:

Sequence, based on SEQRES records: (download)

>d1c9ua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
vltdtagnvqkddgsvtntlenpgslikft

Sequence, based on observed residues (ATOM records): (download)

>d1c9ua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkpnqtiirrytynkstd
tlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqhtptqqe
lngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngkllqseq
gpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkvaagvpv
tkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykggkkaitg
wentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvlyvltdta
gnvqkddgsvtntlenpgslikft

SCOP Domain Coordinates for d1c9ua_:

Click to download the PDB-style file with coordinates for d1c9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1c9ua_: