SCOPe 2.08: Domain d5d3db2: 5d3d B:226-326

Lineage for d5d3db2 (5d3d B:226-326)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [226096] (8 PDB entries)

8. Domain d5d3db2: 5d3d B:226-326 [276227]
   Other proteins in same PDB: d5d3da1, d5d3db1, d5d3db3
   automated match to d4rcob2
   complexed with cl, gol, na, scn

Details for d5d3db2

PDB Entry: 5d3d, 1.94 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 3

PDB Compounds: (B:) Staphylococcal Superantigen-Like protein 3

SCOPe Domain Sequences for d5d3db2:

Sequence; same for both SEQRES and ATOM records:

>d5d3db2 d.15.6.0 (B:226-326) automated matches {Staphylococcus aureus [TaxId: 93061]}
kvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgsgt
ivikmknggkytfelhkklqehrmadvidgtnidnievnik

Timeline for d5d3db2:

• d5d3db2 first appeared in SCOPe 2.05
  
• d5d3db2 appears in SCOPe 2.07