Lineage for d5d3db1 (5d3d B:134-225)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381771Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2382641Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2382642Protein automated matches [226834] (5 species)
    not a true protein
  7. 2382670Species Staphylococcus aureus [TaxId:93061] [226094] (7 PDB entries)
  8. 2382679Domain d5d3db1: 5d3d B:134-225 [276226]
    Other proteins in same PDB: d5d3da2, d5d3db2, d5d3db3
    automated match to d3uryb1
    complexed with cl, gol, na, scn

Details for d5d3db1

PDB Entry: 5d3d (more details), 1.94 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 3
PDB Compounds: (B:) Staphylococcal Superantigen-Like protein 3

SCOPe Domain Sequences for d5d3db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d3db1 b.40.2.0 (B:134-225) automated matches {Staphylococcus aureus [TaxId: 93061]}
mtpkyedlrayytkpsfefekqfgfmlkpwttvrfmnvipnrfiykialvgkdekkykdg
pydnidvfivlednkyqlkkysvggitktnsk

SCOPe Domain Coordinates for d5d3db1:

Click to download the PDB-style file with coordinates for d5d3db1.
(The format of our PDB-style files is described here.)

Timeline for d5d3db1: