SCOPe 2.08: Domain d5bxzb_: 5bxz B:

Lineage for d5bxzb_ (5bxz B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein automated matches [190929] (5 species)
   not a true protein

7. Species Influenza A virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10)) [TaxId:1129345] [276215] (1 PDB entry)

8. Domain d5bxzb_: 5bxz B: [276218]
   automated match to d2z0ac_

Details for d5bxzb_

PDB Entry: 5bxz, 2.6 Å

PDB Description: h17 bat influenza ns1 rna binding domain

PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d5bxzb_:

Sequence; same for both SEQRES and ATOM records:

>d5bxzb_ a.16.1.1 (B:) automated matches {Influenza A virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10)) [TaxId: 1129345]}
epnpttiafqvdcylwhlkktlsmmgevdapfedrlrreqkalkgrsmtlgidiqsatqe
gyykiksite

Timeline for d5bxzb_:

• d5bxzb_ first appeared in SCOPe 2.05
  
• d5bxzb_ appears in SCOPe 2.07