| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) ![]() |
| Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
| Protein automated matches [190929] (6 species) not a true protein |
| Species Influenza a virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10)) [TaxId:1129345] [276215] (1 PDB entry) |
| Domain d5bxza_: 5bxz A: [276217] automated match to d2z0ac_ |
PDB Entry: 5bxz (more details), 2.6 Å
SCOPe Domain Sequences for d5bxza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxza_ a.16.1.1 (A:) automated matches {Influenza a virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10)) [TaxId: 1129345]}
pnpttiafqvdcylwhlkktlsmmgevdapfedrlrreqkalkgrsmtlgidiqsatqeg
yykiksite
Timeline for d5bxza_: