Lineage for d5bxza_ (5bxz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725387Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1725388Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1725389Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 1725398Protein automated matches [190929] (6 species)
    not a true protein
  7. 1725402Species Influenza a virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10)) [TaxId:1129345] [276215] (1 PDB entry)
  8. 1725403Domain d5bxza_: 5bxz A: [276217]
    automated match to d2z0ac_

Details for d5bxza_

PDB Entry: 5bxz (more details), 2.6 Å

PDB Description: h17 bat influenza ns1 rna binding domain
PDB Compounds: (A:) Non-structural protein 1

SCOPe Domain Sequences for d5bxza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxza_ a.16.1.1 (A:) automated matches {Influenza a virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10)) [TaxId: 1129345]}
pnpttiafqvdcylwhlkktlsmmgevdapfedrlrreqkalkgrsmtlgidiqsatqeg
yykiksite

SCOPe Domain Coordinates for d5bxza_:

Click to download the PDB-style file with coordinates for d5bxza_.
(The format of our PDB-style files is described here.)

Timeline for d5bxza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5bxzb_