SCOPe 2.08: Domain d4ztpl2: 4ztp L:108-211

Lineage for d4ztpl2 (4ztp L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d4ztpl2: 4ztp L:108-211 [276214]
   automated match to d4jo4l2

Details for d4ztpl2

PDB Entry: 4ztp, 1.63 Å

PDB Description: fab structure of rabbit monoclonal antibody r53 targeting an epitope in hiv-1 gp120 c4 region

PDB Compounds: (L:) Light chain of Fab fragment of rabbit monoclonal antibody R53

SCOPe Domain Sequences for d4ztpl2:

Sequence; same for both SEQRES and ATOM records:

>d4ztpl2 b.1.1.0 (L:108-211) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gdpvaptvlifppaadqvatgtvtivcvankyfpdvtvtwevdgttqttgiensktpqns
adctynlsstltltstqynshkeytckvtqgttsvvqsfnrgdc

Timeline for d4ztpl2:

• d4ztpl2 first appeared in SCOPe 2.05
  
• d4ztpl2 appears in SCOPe 2.07