Lineage for d4ziza_ (4ziz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2688874Protein Phycocyanin alpha subunit [88933] (10 species)
  7. 2688945Species Thermosynechococcus elongatus [TaxId:197221] [189582] (12 PDB entries)
  8. 2688949Domain d4ziza_: 4ziz A: [276212]
    Other proteins in same PDB: d4zizb_
    automated match to d1jboa_
    complexed with cyc

Details for d4ziza_

PDB Entry: 4ziz (more details), 1.75 Å

PDB Description: serial femtosecond crystallography of soluble proteins in lipidic cubic phase (c-phycocyanin from t. elongatus)
PDB Compounds: (A:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d4ziza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ziza_ a.1.1.3 (A:) Phycocyanin alpha subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmvtyclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOPe Domain Coordinates for d4ziza_:

Click to download the PDB-style file with coordinates for d4ziza_.
(The format of our PDB-style files is described here.)

Timeline for d4ziza_: