Lineage for d4zizb_ (4ziz B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2301942Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302043Protein Phycocyanin beta subunit [88940] (8 species)
  7. 2302087Species Thermosynechococcus elongatus [TaxId:197221] [189583] (9 PDB entries)
  8. 2302089Domain d4zizb_: 4ziz B: [276211]
    Other proteins in same PDB: d4ziza_
    automated match to d1ktpb_
    complexed with cyc

Details for d4zizb_

PDB Entry: 4ziz (more details), 1.75 Å

PDB Description: serial femtosecond crystallography of soluble proteins in lipidic cubic phase (c-phycocyanin from t. elongatus)
PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d4zizb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zizb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOPe Domain Coordinates for d4zizb_:

Click to download the PDB-style file with coordinates for d4zizb_.
(The format of our PDB-style files is described here.)

Timeline for d4zizb_: