Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) automatically mapped to Pfam PF02531 |
Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
Protein automated matches [236562] (2 species) not a true protein |
Species Pisum sativum [TaxId:3888] [276208] (1 PDB entry) |
Domain d4y28d_: 4y28 D: [276210] Other proteins in same PDB: d4y282_, d4y28a_, d4y28b_, d4y28c_, d4y28e_, d4y28f_, d4y28j_ automated match to d4kt0d_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex |
PDB Entry: 4y28 (more details), 2.8 Å
SCOPe Domain Sequences for d4y28d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y28d_ d.187.1.1 (D:) automated matches {Pisum sativum [TaxId: 3888]} tppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnll klarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfr sigknvspievkftgkqpydl
Timeline for d4y28d_: