Lineage for d4y28d_ (4y28 D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943670Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 1943671Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 1943672Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 1943676Protein automated matches [236562] (2 species)
    not a true protein
  7. 1943677Species Pisum sativum [TaxId:3888] [276208] (1 PDB entry)
  8. 1943678Domain d4y28d_: 4y28 D: [276210]
    Other proteins in same PDB: d4y282_, d4y28a_, d4y28b_, d4y28c_, d4y28e_, d4y28f_, d4y28j_
    automated match to d4kt0d_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y28d_

PDB Entry: 4y28 (more details), 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.
PDB Compounds: (D:) photosystem I reaction center subunit II, chloroplastic

SCOPe Domain Sequences for d4y28d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y28d_ d.187.1.1 (D:) automated matches {Pisum sativum [TaxId: 3888]}
tppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnll
klarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfr
sigknvspievkftgkqpydl

SCOPe Domain Coordinates for d4y28d_:

Click to download the PDB-style file with coordinates for d4y28d_.
(The format of our PDB-style files is described here.)

Timeline for d4y28d_: