Lineage for d1cq1a_ (1cq1 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398814Superfamily b.68.2: Soluble quinoprotein glucose dehydrogenase [50952] (1 family) (S)
  5. 2398815Family b.68.2.1: Soluble quinoprotein glucose dehydrogenase [50953] (2 protein domains)
  6. 2398816Protein Soluble quinoprotein glucose dehydrogenase [50954] (1 species)
  7. 2398817Species Acinetobacter calcoaceticus [TaxId:471] [50955] (4 PDB entries)
  8. 2398822Domain d1cq1a_: 1cq1 A: [27621]
    complexed with bgc, ca, pqq

Details for d1cq1a_

PDB Entry: 1cq1 (more details), 1.9 Å

PDB Description: soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose
PDB Compounds: (A:) soluble quinoprotein glucose dehydrogenase

SCOPe Domain Sequences for d1cq1a_:

Sequence, based on SEQRES records: (download)

>d1cq1a_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
vltdtagnvqkddgsvtntlenpgslikft

Sequence, based on observed residues (ATOM records): (download)

>d1cq1a_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkpnqtiirrytynkstd
tlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqhtptqqe
lngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngkllqseq
gpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkvaagvpv
tkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykggkkaitg
wentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvlyvltdta
gnvqkddgsvtntlenpgslikft

SCOPe Domain Coordinates for d1cq1a_:

Click to download the PDB-style file with coordinates for d1cq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1cq1a_: