Lineage for d4y28e_ (4y28 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393472Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2393473Protein automated matches [191237] (6 species)
    not a true protein
  7. 2393522Species Pisum sativum [TaxId:4096] [276206] (1 PDB entry)
  8. 2393523Domain d4y28e_: 4y28 E: [276209]
    Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28f_, d4y28j_
    automated match to d1qp2a_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y28e_

PDB Entry: 4y28 (more details), 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.
PDB Compounds: (E:) photosystem I reaction center subunit IV a, chloroplastic

SCOPe Domain Sequences for d4y28e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y28e_ b.34.4.0 (E:) automated matches {Pisum sativum [TaxId: 4096]}
ppigpkrgakvkilrqesywykgtgsvvtvdqdpntrypvvvrfnkvnyanvstnnyald
eveevk

SCOPe Domain Coordinates for d4y28e_:

Click to download the PDB-style file with coordinates for d4y28e_.
(The format of our PDB-style files is described here.)

Timeline for d4y28e_: