Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
Protein automated matches [191237] (3 species) not a true protein |
Species Pisum sativum [TaxId:4096] [276206] (1 PDB entry) |
Domain d4y28e_: 4y28 E: [276209] Other proteins in same PDB: d4y282_, d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28f_, d4y28j_ automated match to d1qp2a_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex |
PDB Entry: 4y28 (more details), 2.8 Å
SCOPe Domain Sequences for d4y28e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y28e_ b.34.4.0 (E:) automated matches {Pisum sativum [TaxId: 4096]} ppigpkrgakvkilrqesywykgtgsvvtvdqdpntrypvvvrfnkvnyanvstnnyald eveevk
Timeline for d4y28e_: