SCOPe 2.08: Domain d4y28e1: 4y28 E:64-124

Lineage for d4y28e1 (4y28 E:64-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.0: automated matches [191659] (1 protein)
   not a true family

6. Protein automated matches [191237] (8 species)
   not a true protein

7. Species Pisum sativum [TaxId:4096] [276206] (1 PDB entry)

8. Domain d4y28e1: 4y28 E:64-124 [276209]
   Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e2, d4y28f_, d4y28j_, d4y28l_
   automated match to d1qp2a_
   complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y28e1

PDB Entry: 4y28, 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.

PDB Compounds: (E:) photosystem I reaction center subunit IV a, chloroplastic

SCOPe Domain Sequences for d4y28e1:

Sequence; same for both SEQRES and ATOM records:

>d4y28e1 b.34.4.0 (E:64-124) automated matches {Pisum sativum [TaxId: 4096]}
ppigpkrgakvkilrqesywykgtgsvvtvdqdpntrypvvvrfnkvnyanvstnnyald
e

Timeline for d4y28e1:

• d4y28e1 first appeared in SCOPe 2.05, called d4y28e_
  
• d4y28e1 was called d4y28e_ in SCOPe 2.07