Lineage for d4y282_ (4y28 2:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633630Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2633631Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2633682Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2633683Protein automated matches [276200] (4 species)
    not a true protein
  7. 2633718Species Pea (Pisum sativum) [TaxId:3888] [276203] (9 PDB entries)
  8. 2633747Domain d4y282_: 4y28 2: [276207]
    Other proteins in same PDB: d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e_, d4y28f_, d4y28j_
    automated match to d4lcza_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y282_

PDB Entry: 4y28 (more details), 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.
PDB Compounds: (2:) Type II chlorophyll a/b binding protein from photosystem I

SCOPe Domain Sequences for d4y282_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y282_ f.43.1.0 (2:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
vaepdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlgaa
gifipefltklgilltpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcvn
tdpifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawfq
hiytgtgpidnlfahladpghatifaa

SCOPe Domain Coordinates for d4y282_:

Click to download the PDB-style file with coordinates for d4y282_.
(The format of our PDB-style files is described here.)

Timeline for d4y282_: