Lineage for d4y28f_ (4y28 F:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958291Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 1958299Family f.23.16.0: automated matches [276195] (1 protein)
    not a true family
  6. 1958300Protein automated matches [276199] (1 species)
    not a true protein
  7. 1958301Species Pisum sativum [TaxId:3888] [276202] (1 PDB entry)
  8. 1958302Domain d4y28f_: 4y28 F: [276205]
    Other proteins in same PDB: d4y282_, d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e_, d4y28j_
    automated match to d1jb0f_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y28f_

PDB Entry: 4y28 (more details), 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.
PDB Compounds: (F:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d4y28f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y28f_ f.23.16.0 (F:) automated matches {Pisum sativum [TaxId: 3888]}
sgltpckeskqfakrekqsikklesslkiyaadsapalainatiektkrrfdnyakqgll
cgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairdekkptqkeiiid
vplasrlvfrgfswpiaayrellngelvak

SCOPe Domain Coordinates for d4y28f_:

Click to download the PDB-style file with coordinates for d4y28f_.
(The format of our PDB-style files is described here.)

Timeline for d4y28f_: