SCOPe 2.05: Domain d4y28j_: 4y28 J:

Lineage for d4y28j_ (4y28 J:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families)
   automatically mapped to Pfam PF01701

5. Family f.23.18.0: automated matches [276196] (1 protein)
   not a true family

6. Protein automated matches [276198] (1 species)
   not a true protein

7. Species Pisum sativum [TaxId:3888] [276201] (1 PDB entry)

8. Domain d4y28j_: 4y28 J: [276204]
   Other proteins in same PDB: d4y282_, d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e_, d4y28f_
   automated match to d1jb0j_
   complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y28j_

PDB Entry: 4y28, 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.

PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d4y28j_:

Sequence; same for both SEQRES and ATOM records:

>d4y28j_ f.23.18.0 (J:) automated matches {Pisum sativum [TaxId: 3888]}
rdlktylsvapvastlwfaalagllieinrlfpdaltfpff

Timeline for d4y28j_:

• d4y28j_ is new in SCOPe 2.05-stable
  
• d4y28j_ appears in SCOPe 2.06
  
• d4y28j_ appears in the current release, SCOPe 2.08