Lineage for d4y28j_ (4y28 J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026183Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 3026208Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 3026209Protein automated matches [276198] (5 species)
    not a true protein
  7. 3026223Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries)
  8. 3026231Domain d4y28j_: 4y28 J: [276204]
    Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e1, d4y28e2, d4y28f_, d4y28l_
    automated match to d1jb0j_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y28j_

PDB Entry: 4y28 (more details), 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d4y28j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y28j_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
rdlktylsvapvastlwfaalagllieinrlfpdaltfpff

SCOPe Domain Coordinates for d4y28j_:

Click to download the PDB-style file with coordinates for d4y28j_.
(The format of our PDB-style files is described here.)

Timeline for d4y28j_: