Lineage for d4wr4a2 (4wr4 A:80-216)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736720Species Schistosoma japonicum [TaxId:6182] [276183] (2 PDB entries)
  8. 1736721Domain d4wr4a2: 4wr4 A:80-216 [276186]
    Other proteins in same PDB: d4wr4a1
    automated match to d3isoa2
    complexed with gsh, so4

Details for d4wr4a2

PDB Entry: 4wr4 (more details), 1.6 Å

PDB Description: crystal structure of gst mutated with halogenated tyrosine (7bgst-1)
PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d4wr4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wr4a2 a.45.1.0 (A:80-216) automated matches {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
txlngdhvthpdfmlydaldvvlxmdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhpp

SCOPe Domain Coordinates for d4wr4a2:

Click to download the PDB-style file with coordinates for d4wr4a2.
(The format of our PDB-style files is described here.)

Timeline for d4wr4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wr4a1