SCOPe 2.08: Domain d4wr4a2: 4wr4 A:80-216

Lineage for d4wr4a2 (4wr4 A:80-216)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Schistosoma japonicum [TaxId:6182] [276183] (5 PDB entries)

8. Domain d4wr4a2: 4wr4 A:80-216 [276186]
   Other proteins in same PDB: d4wr4a1, d4wr4a3
   automated match to d3isoa2
   complexed with gsh, so4

Details for d4wr4a2

PDB Entry: 4wr4, 1.6 Å

PDB Description: crystal structure of gst mutated with halogenated tyrosine (7bgst-1)

PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d4wr4a2:

Sequence; same for both SEQRES and ATOM records:

>d4wr4a2 a.45.1.0 (A:80-216) automated matches {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
txlngdhvthpdfmlydaldvvlxmdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhpp

Timeline for d4wr4a2:

• d4wr4a2 first appeared in SCOPe 2.05
  
• d4wr4a2 appears in SCOPe 2.07