Lineage for d4wr5a2 (4wr5 A:80-216)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327349Species Schistosoma japonicum [TaxId:6182] [276183] (5 PDB entries)
  8. 2327352Domain d4wr5a2: 4wr5 A:80-216 [276184]
    Other proteins in same PDB: d4wr5a1, d4wr5a3
    automated match to d3isoa2
    complexed with gsh, so4

Details for d4wr5a2

PDB Entry: 4wr5 (more details), 1.93 Å

PDB Description: crystal structure of gst mutated with halogenated tyrosine (7cgst-1)
PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d4wr5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wr5a2 a.45.1.0 (A:80-216) automated matches {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
txlngdhvthpdfmlydaldvvlxmdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhpp

SCOPe Domain Coordinates for d4wr5a2:

Click to download the PDB-style file with coordinates for d4wr5a2.
(The format of our PDB-style files is described here.)

Timeline for d4wr5a2: