Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (64 species) not a true protein |
Species Aspergillus fumigatus [TaxId:746128] [276175] (3 PDB entries) |
Domain d4uyla1: 4uyl A:50-518 [276176] Other proteins in same PDB: d4uyla2, d4uylb2 automated match to d3k1oa_ complexed with hem, vni |
PDB Entry: 4uyl (more details), 2.81 Å
SCOPe Domain Sequences for d4uyla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uyla1 a.104.1.0 (A:50-518) automated matches {Aspergillus fumigatus [TaxId: 746128]} ktppvvfhwfpfigstisygidpykfffdcrakygdiftfillgkkttvylgtkgndfil ngklrdvcaeevysplttpvfgrhvvydcpnaklmeqkkfvkygltsdalrsyvplitde vesfvknspafqghkgvfdvcktiaeitiytasrslqgkevrskfdstfaelyhnldmgf apinfmlpwaplphnrkrdaaqrkltetymeiikarrqagskkdsedmvwnlmscvykng tpvpdeeiahmmiallmagqhsssstaswivlrlatrpdimeelyqeqirvlgsdlpplt ydnlqkldlhakviketlrlhapihsiiravknpmavdgtsyviptshnvlsspgvtars eehfpnplewnphrwdeniaasaeddekvdygyglvskgtnspylpfgagrhrcigeqfa ylqlgtitavlvrlfrfrnlpgvdgipdtdysslfskplgrsfvefekr
Timeline for d4uyla1: