Lineage for d4rexa1 (4rex A:165-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401160Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2401161Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2401162Family b.72.1.1: WW domain [51046] (13 protein domains)
  6. 2401255Protein automated matches [192459] (3 species)
    not a true protein
  7. 2401258Species Human (Homo sapiens) [TaxId:9606] [161325] (20 PDB entries)
  8. 2401259Domain d4rexa1: 4rex A:165-208 [276174]
    Other proteins in same PDB: d4rexa2
    automated match to d1jmqa_
    complexed with so4

Details for d4rexa1

PDB Entry: 4rex (more details), 1.6 Å

PDB Description: crystal structure of the first ww domain of human yap2 isoform
PDB Compounds: (A:) Yorkie homolog

SCOPe Domain Sequences for d4rexa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rexa1 b.72.1.1 (A:165-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
feipddvplpagwemaktssgqryflnhidqtttwqdprkamls

SCOPe Domain Coordinates for d4rexa1:

Click to download the PDB-style file with coordinates for d4rexa1.
(The format of our PDB-style files is described here.)

Timeline for d4rexa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rexa2