Lineage for d1crua_ (1cru A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065559Superfamily b.68.2: Soluble quinoprotein glucose dehydrogenase [50952] (1 family) (S)
  5. 2065560Family b.68.2.1: Soluble quinoprotein glucose dehydrogenase [50953] (1 protein)
  6. 2065561Protein Soluble quinoprotein glucose dehydrogenase [50954] (1 species)
  7. 2065562Species Acinetobacter calcoaceticus [TaxId:471] [50955] (4 PDB entries)
  8. 2065563Domain d1crua_: 1cru A: [27617]
    complexed with ca, gol, hdn, pqq

Details for d1crua_

PDB Entry: 1cru (more details), 1.5 Å

PDB Description: soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine
PDB Compounds: (A:) protein (soluble quinoprotein glucose dehydrogenase)

SCOPe Domain Sequences for d1crua_:

Sequence, based on SEQRES records: (download)

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
vltdtagnvqkddgsvtntlenpgslikft

Sequence, based on observed residues (ATOM records): (download)

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkskelpnqtiirrytyn
kstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqhtp
tqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngkll
qseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkvaa
gvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykggkk
aitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvlyvl
tdtagnvqkddgsvtntlenpgslikft

SCOPe Domain Coordinates for d1crua_:

Click to download the PDB-style file with coordinates for d1crua_.
(The format of our PDB-style files is described here.)

Timeline for d1crua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1crub_