Lineage for d4qzpb1 (4qzp B:36-443)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002950Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 protein domains)
    duplication: tandem repeat of two CCP-like domains
  6. 2003049Protein automated matches [227103] (4 species)
    not a true protein
  7. 2003063Species Burkholderia pseudomallei [TaxId:557724] [256912] (6 PDB entries)
  8. 2003074Domain d4qzpb1: 4qzp B:36-443 [276163]
    automated match to d3n3oa1
    complexed with cl, hem, mpd, na

Details for d4qzpb1

PDB Entry: 4qzp (more details), 1.77 Å

PDB Description: burkholderia pseudomallei catalase-peroxidase variant w139f
PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d4qzpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qzpb1 a.93.1.3 (B:36-443) automated matches {Burkholderia pseudomallei [TaxId: 557724]}
gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
padfghygglfirmawhsagtyrtadgrggagegqqrfaplnsfpdnanldkarrllwpi
kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

SCOPe Domain Coordinates for d4qzpb1:

Click to download the PDB-style file with coordinates for d4qzpb1.
(The format of our PDB-style files is described here.)

Timeline for d4qzpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qzpb2