Lineage for d1kit_3 (1kit 217-346,544-781)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114090Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
  4. 114091Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 114092Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 114188Protein Vibrio cholerae sialidase [50950] (1 species)
  7. 114189Species Vibrio cholerae [TaxId:666] [50951] (1 PDB entry)
  8. 114190Domain d1kit_3: 1kit 217-346,544-781 [27616]
    Other proteins in same PDB: d1kit_1, d1kit_2

Details for d1kit_3

PDB Entry: 1kit (more details), 2.3 Å

PDB Description: vibrio cholerae neuraminidase

SCOP Domain Sequences for d1kit_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kit_3 b.68.1.1 (217-346,544-781) Vibrio cholerae sialidase {Vibrio cholerae}
vifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrtsrdggitwdtel
nlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikpwmpngifysvyd
vasgnwqapiXvnpgpghgitltrqqnisgsqngrliypaivldrfflnvmsiysddggs
nwqtgstlpipfrwksssiletlepseadmvelqngdllltarldfnqivngvnysprqq
flskdggitwslleannanvfsnistgtvdasitrfeqsdgshfllftnpqgnpagtngr
qnlglwfsfdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpitll
kqkltlsqn

SCOP Domain Coordinates for d1kit_3:

Click to download the PDB-style file with coordinates for d1kit_3.
(The format of our PDB-style files is described here.)

Timeline for d1kit_3: