Lineage for d4qyje_ (4qyj E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141510Species Pseudomonas putida [TaxId:1215087] [276150] (1 PDB entry)
  8. 2141515Domain d4qyje_: 4qyj E: [276154]
    automated match to d3ek1a_

Details for d4qyje_

PDB Entry: 4qyj (more details), 2.83 Å

PDB Description: structure of phenylacetaldehyde dehydrogenase from pseudomonas putida s12
PDB Compounds: (E:) aldehyde dehydrogenase

SCOPe Domain Sequences for d4qyje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qyje_ c.82.1.0 (E:) automated matches {Pseudomonas putida [TaxId: 1215087]}
qmliggqwvsaqsgktlnvynpatgdiltevpdgdvedvnaavesaaatlrsdtwrrmpp
sarerillrladllevhgdelarletlnngklliysklmevgasaqwlrymagwatkltg
stldlslplppevrsrastqrvpvgvvaaiipwnfpllmavwkiapalacgntvvlkpae
etpltalrlaelameaglpagalnvvtgrgetagdalvrhpkvakvaftgstevgriigs
acgrslkavslelggkspvivladcdpqeaaegaaaaiffnhgqvctagsrlyvhesiye
dviqrlavigesivvgsgleqgvhmgpmvskkhhenvlrhirngiedgadlicggteapc
aqgffvkptifanrekkdirllsqevfgpvlvatpfsdiaevvneanrsvyglgasiwtn
dlsaalrindeleagtvwvnthnmvdpnlpfggfkdsgvgrehgaaaiehytttrslvia
y

SCOPe Domain Coordinates for d4qyje_:

Click to download the PDB-style file with coordinates for d4qyje_.
(The format of our PDB-style files is described here.)

Timeline for d4qyje_: