Lineage for d1slia2 (1sli A:277-759)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065176Protein Leech intramolecular trans-sialidase, C-terminal domain [50948] (1 species)
    contains incomplete beta-barrel subdomain inserted in the second blade
  7. 2065177Species North american leech (Macrobdella decora) [TaxId:6405] [50949] (5 PDB entries)
  8. 2065181Domain d1slia2: 1sli A:277-759 [27615]
    Other proteins in same PDB: d1slia1
    complexed with dan

Details for d1slia2

PDB Entry: 1sli (more details), 2 Å

PDB Description: leech intramolecular trans-sialidase complexed with dana
PDB Compounds: (A:) intramolecular trans-sialidase

SCOPe Domain Sequences for d1slia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slia2 b.68.1.1 (A:277-759) Leech intramolecular trans-sialidase, C-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]}
genifyagdvtesnyfripslltlstgtvisaadaryggthdskskiniafakstdggnt
wseptlplkfddyiaknidwprdsvgknvqiqgsasyidpvlledkltkriflfadlmpa
gigssnasvgsgfkevngkkylklrwhkdagraydytirekgviyndatnqptefrvdge
ynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvfkafptnylamrysdde
gaswsdldivssfkpevskflvvgpgigkqistgenagrllvplyskssaelgfmysddh
gdnwtyveadnltggataeaqivempdgslktylrtgsnciaevtsidggetwsdrvplq
gisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwiglvndtgntgidkysv
ewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelhlkdilkfekysiselt
gqa

SCOPe Domain Coordinates for d1slia2:

Click to download the PDB-style file with coordinates for d1slia2.
(The format of our PDB-style files is described here.)

Timeline for d1slia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1slia1