SCOPe 2.08: Domain d4qwqa_: 4qwq A:

Lineage for d4qwqa_ (4qwq A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225593] (6 PDB entries)

8. Domain d4qwqa_: 4qwq A: [276149]
   automated match to d4ixaa_

Details for d4qwqa_

PDB Entry: 4qwq, 2.5 Å

PDB Description: crystal structure of the dna-binding domain of the response regulator saer from staphylococcus aureus

PDB Compounds: (A:) Response regulator SaeR

SCOPe Domain Sequences for d4qwqa_:

Sequence, based on SEQRES records:

>d4qwqa_ a.4.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydyy
edantvnvhihrireklekesfttytittvwglgykfers

Sequence, based on observed residues (ATOM records):

>d4qwqa_ a.4.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydan
tvnvhihrireklekesfttytittvwglgykfers

Timeline for d4qwqa_:

• d4qwqa_ first appeared in SCOPe 2.05
  
• d4qwqa_ appears in SCOPe 2.07