Lineage for d4qwqa_ (4qwq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695386Species Staphylococcus aureus [TaxId:1280] [225593] (6 PDB entries)
  8. 2695393Domain d4qwqa_: 4qwq A: [276149]
    automated match to d4ixaa_

Details for d4qwqa_

PDB Entry: 4qwq (more details), 2.5 Å

PDB Description: crystal structure of the dna-binding domain of the response regulator saer from staphylococcus aureus
PDB Compounds: (A:) Response regulator SaeR

SCOPe Domain Sequences for d4qwqa_:

Sequence, based on SEQRES records: (download)

>d4qwqa_ a.4.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydyy
edantvnvhihrireklekesfttytittvwglgykfers

Sequence, based on observed residues (ATOM records): (download)

>d4qwqa_ a.4.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydan
tvnvhihrireklekesfttytittvwglgykfers

SCOPe Domain Coordinates for d4qwqa_:

Click to download the PDB-style file with coordinates for d4qwqa_.
(The format of our PDB-style files is described here.)

Timeline for d4qwqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4qwqb_