Lineage for d4qywa_ (4qyw A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464447Species Thermotoga maritima [TaxId:243274] [227724] (2 PDB entries)
  8. 2464449Domain d4qywa_: 4qyw A: [276148]
    automated match to d2iynb_

Details for d4qywa_

PDB Entry: 4qyw (more details), 1.6 Å

PDB Description: structure of phosphono-chey from t.maritima
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4qywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qywa_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmcitmpemn
gidaikeimkidpnakiivasamgqqamvieaikagakdfivkpfqpsrvvealnkvs

SCOPe Domain Coordinates for d4qywa_:

Click to download the PDB-style file with coordinates for d4qywa_.
(The format of our PDB-style files is described here.)

Timeline for d4qywa_: