Lineage for d5cvxa1 (5cvx A:1-93)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998362Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 1998363Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 1998428Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 1998429Protein automated matches [191007] (8 species)
    not a true protein
  7. 1998443Species Spiroplasma melliferum [TaxId:570509] [260909] (4 PDB entries)
  8. 1998445Domain d5cvxa1: 5cvx A:1-93 [276146]
    Other proteins in same PDB: d5cvxa2
    automated match to d4n1va_

Details for d5cvxa1

PDB Entry: 5cvx (more details), 1.36 Å

PDB Description: structure of dna-binding protein hu from micoplasma spiroplasma melliferum
PDB Compounds: (A:) DNA-binding protein

SCOPe Domain Sequences for d5cvxa1:

Sequence, based on SEQRES records: (download)

>d5cvxa1 a.55.1.0 (A:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrnpstgetikipasksakfkagkqlktdlnn

Sequence, based on observed residues (ATOM records): (download)

>d5cvxa1 a.55.1.0 (A:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrntgetikipasksakfkagkqlktdlnn

SCOPe Domain Coordinates for d5cvxa1:

Click to download the PDB-style file with coordinates for d5cvxa1.
(The format of our PDB-style files is described here.)

Timeline for d5cvxa1:

  • d5cvxa1 first appeared in SCOPe 2.05, called d5cvxa_

View in 3D
Domains from same chain:
(mouse over for more information)
d5cvxa2