SCOPe 2.06: Domain d5cy4b_: 5cy4 B:

Lineage for d5cy4b_ (5cy4 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [276138] (1 PDB entry)

8. Domain d5cy4b_: 5cy4 B: [276143]
   Other proteins in same PDB: d5cy4a2, d5cy4c2, d5cy4d2, d5cy4e2
   automated match to d2gbza_
   complexed with ca, edo

Details for d5cy4b_

PDB Entry: 5cy4, 2.25 Å

PDB Description: crystal structure of an oligoribonuclease from acinetobacter baumannii

PDB Compounds: (B:) Oligoribonuclease

SCOPe Domain Sequences for d5cy4b_:

Sequence, based on SEQRES records:

>d5cy4b_ c.55.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
sstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnamde
wntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhrlm
peleqyfhyrnldvstvkelskrwrpeimsglkknashlamddirdsiselkyyreyffi
mn

Sequence, based on observed residues (ATOM records):

>d5cy4b_ c.55.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
sstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnamde
wntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhrlm
peleqyfhyrnldvstvkelskrwrpeimsglhlamddirdsiselkyyreyffimn

Timeline for d5cy4b_:

• d5cy4b_ first appeared in SCOPe 2.05
  
• d5cy4b_ appears in SCOPe 2.07
  
• d5cy4b_ appears in the current release, SCOPe 2.08