Lineage for d5cy4b_ (5cy4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887218Species Acinetobacter baumannii [TaxId:470] [276138] (1 PDB entry)
  8. 2887220Domain d5cy4b_: 5cy4 B: [276143]
    Other proteins in same PDB: d5cy4a2, d5cy4c2, d5cy4d2, d5cy4e2
    automated match to d2gbza_
    complexed with ca, edo

Details for d5cy4b_

PDB Entry: 5cy4 (more details), 2.25 Å

PDB Description: crystal structure of an oligoribonuclease from acinetobacter baumannii
PDB Compounds: (B:) Oligoribonuclease

SCOPe Domain Sequences for d5cy4b_:

Sequence, based on SEQRES records: (download)

>d5cy4b_ c.55.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
sstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnamde
wntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhrlm
peleqyfhyrnldvstvkelskrwrpeimsglkknashlamddirdsiselkyyreyffi
mn

Sequence, based on observed residues (ATOM records): (download)

>d5cy4b_ c.55.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
sstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnamde
wntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhrlm
peleqyfhyrnldvstvkelskrwrpeimsglhlamddirdsiselkyyreyffimn

SCOPe Domain Coordinates for d5cy4b_:

Click to download the PDB-style file with coordinates for d5cy4b_.
(The format of our PDB-style files is described here.)

Timeline for d5cy4b_: