![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:470] [276138] (1 PDB entry) |
![]() | Domain d5cy4b_: 5cy4 B: [276143] Other proteins in same PDB: d5cy4a2, d5cy4c2, d5cy4d2, d5cy4e2 automated match to d2gbza_ complexed with ca, edo |
PDB Entry: 5cy4 (more details), 2.25 Å
SCOPe Domain Sequences for d5cy4b_:
Sequence, based on SEQRES records: (download)
>d5cy4b_ c.55.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]} sstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnamde wntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhrlm peleqyfhyrnldvstvkelskrwrpeimsglkknashlamddirdsiselkyyreyffi mn
>d5cy4b_ c.55.3.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]} sstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnamde wntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhrlm peleqyfhyrnldvstvkelskrwrpeimsglhlamddirdsiselkyyreyffimn
Timeline for d5cy4b_: