Lineage for d5cy4d1 (5cy4 D:1-183)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2464026Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2464027Protein automated matches [190396] (36 species)
    not a true protein
  7. 2464028Species Acinetobacter baumannii [TaxId:470] [276138] (1 PDB entry)
  8. 2464032Domain d5cy4d1: 5cy4 D:1-183 [276141]
    Other proteins in same PDB: d5cy4a2, d5cy4c2, d5cy4d2, d5cy4e2
    automated match to d2gbza_
    complexed with ca, edo

Details for d5cy4d1

PDB Entry: 5cy4 (more details), 2.25 Å

PDB Description: crystal structure of an oligoribonuclease from acinetobacter baumannii
PDB Compounds: (D:) Oligoribonuclease

SCOPe Domain Sequences for d5cy4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cy4d1 c.55.3.0 (D:1-183) automated matches {Acinetobacter baumannii [TaxId: 470]}
msstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnamd
ewntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhrl
mpeleqyfhyrnldvstvkelskrwrpeimsglkknashlamddirdsiselkyyreyff
imn

SCOPe Domain Coordinates for d5cy4d1:

Click to download the PDB-style file with coordinates for d5cy4d1.
(The format of our PDB-style files is described here.)

Timeline for d5cy4d1: