Lineage for d1sll_2 (1sll 277-759)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62715Fold b.68: 6-bladed beta-propeller [50938] (6 superfamilies)
  4. 62716Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 62717Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 62785Protein Leech intramolecular trans-sialidase, C-terminal domain [50948] (1 species)
  7. 62786Species North american leech (Macrobdella decora) [TaxId:6405] [50949] (5 PDB entries)
  8. 62791Domain d1sll_2: 1sll 277-759 [27614]
    Other proteins in same PDB: d1sll_1

Details for d1sll_2

PDB Entry: 1sll (more details), 2 Å

PDB Description: sialidase l from leech macrobdella decora

SCOP Domain Sequences for d1sll_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sll_2 b.68.1.1 (277-759) Leech intramolecular trans-sialidase, C-terminal domain {North american leech (Macrobdella decora)}
genifyagdvtesnyfripslltlstgtvisaadaryggthdskskiniafakstdggnt
wseptlplkfddyiaknidwprdsvgknvqiqgsasyidpvlledkltkriflfadlmpa
gigssnasvgsgfkevngkkylklrwhkdagraydytirekgviyndatnqptefrvdge
ynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvfkafptnylamrysdde
gaswsdldivssfkpevskflvvgpgigkqistgenagrllvplyskssaelgfmysddh
gdnwtyveadnltggataeaqivempdgslktylrtgsnciaevtsidggetwsdrvplq
gisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwiglvndtgntgidkysv
ewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelhlkdilkfekysiselt
gqa

SCOP Domain Coordinates for d1sll_2:

Click to download the PDB-style file with coordinates for d1sll_2.
(The format of our PDB-style files is described here.)

Timeline for d1sll_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sll_1