Lineage for d5cqba_ (5cqb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919043Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2919044Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2919045Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 2919046Protein Undecaprenyl diphosphate synthase [64007] (3 species)
  7. 2919050Species Escherichia coli [TaxId:562] [64009] (17 PDB entries)
  8. 2919081Domain d5cqba_: 5cqb A: [276137]
    automated match to d1x07a_
    complexed with pge

Details for d5cqba_

PDB Entry: 5cqb (more details), 2.2 Å

PDB Description: crystal structure of e. coli undecaprenyl pyrophosphate synthase
PDB Compounds: (A:) Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

SCOPe Domain Sequences for d5cqba_:

Sequence, based on SEQRES records: (download)

>d5cqba_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
enwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealta
gntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlv
irtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr

Sequence, based on observed residues (ATOM records): (download)

>d5cqba_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyaffv
waldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwd
ivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqia
yaelyftdvlwpdfdeqdfegalnafanr

SCOPe Domain Coordinates for d5cqba_:

Click to download the PDB-style file with coordinates for d5cqba_.
(The format of our PDB-style files is described here.)

Timeline for d5cqba_: