SCOPe 2.08: Domain d5cqjb_: 5cqj B:

Lineage for d5cqjb_ (5cqj B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein Undecaprenyl diphosphate synthase [64007] (3 species)

7. Species Escherichia coli [TaxId:562] [64009] (17 PDB entries)

8. Domain d5cqjb_: 5cqj B: [276135]
   automated match to d1ueha_
   complexed with 53q

Details for d5cqjb_

PDB Entry: 5cqj, 2.15 Å

PDB Description: crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with clomiphene

PDB Compounds: (B:) Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

SCOPe Domain Sequences for d5cqjb_:

Sequence, based on SEQRES records:

>d5cqjb_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Sequence, based on observed residues (ATOM records):

>d5cqjb_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyaffvwald
sevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivqg
vrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayael
yftdvlwpdfdeqdfegalnafanre

Timeline for d5cqjb_:

• d5cqjb_ first appeared in SCOPe 2.05
  
• d5cqjb_ appears in SCOPe 2.07