| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
| Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
| Protein automated matches [190929] (8 species) not a true protein |
| Species Influenza A virus (a/flat-faced bat/peru/033/2010(h18n11)) [TaxId:1395524] [276129] (1 PDB entry) |
| Domain d5by1a_: 5by1 A: [276132] automated match to d3m8ac_ complexed with 1pe, peg |
PDB Entry: 5by1 (more details), 1.75 Å
SCOPe Domain Sequences for d5by1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5by1a_ a.16.1.1 (A:) automated matches {Influenza A virus (a/flat-faced bat/peru/033/2010(h18n11)) [TaxId: 1395524]}
mestpttiafqvdcylwhlkkmlslmgevdapfedrlrreqkalkgrsmtlgidiqaatk
agyykiksite
Timeline for d5by1a_: