Lineage for d5by1b_ (5by1 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725387Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1725388Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1725389Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 1725398Protein automated matches [190929] (6 species)
    not a true protein
  7. 1725399Species Influenza a virus (a/flat-faced bat/peru/033/2010(h18n11)) [TaxId:1395524] [276129] (1 PDB entry)
  8. 1725401Domain d5by1b_: 5by1 B: [276131]
    automated match to d3m8ac_
    complexed with 1pe, peg

Details for d5by1b_

PDB Entry: 5by1 (more details), 1.75 Å

PDB Description: h18 bat influenza ns1 rna binding domain
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d5by1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5by1b_ a.16.1.1 (B:) automated matches {Influenza a virus (a/flat-faced bat/peru/033/2010(h18n11)) [TaxId: 1395524]}
tpttiafqvdcylwhlkkmlslmgevdapfedrlrreqkalkgrsmtlgidiqaatkagy
ykiksitedam

SCOPe Domain Coordinates for d5by1b_:

Click to download the PDB-style file with coordinates for d5by1b_.
(The format of our PDB-style files is described here.)

Timeline for d5by1b_: