Lineage for d3sli_2 (3sli 277-759)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17044Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies)
  4. 17045Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 17046Family b.68.1.1: Sialidases (neuraminidases) [50940] (5 proteins)
  6. 17110Protein Leech intramolecular trans-sialidase, C-terminal domain [50948] (1 species)
  7. 17111Species North american leech (Macrobdella decora) [TaxId:6405] [50949] (5 PDB entries)
  8. 17114Domain d3sli_2: 3sli 277-759 [27613]
    Other proteins in same PDB: d3sli_1

Details for d3sli_2

PDB Entry: 3sli (more details), 1.8 Å

PDB Description: leech intramolecular trans-sialidase complexed with 2,7-anhydro-neu5ac prepared by soaking with 3'-sialyllactose

SCOP Domain Sequences for d3sli_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sli_2 b.68.1.1 (277-759) Leech intramolecular trans-sialidase, C-terminal domain {North american leech (Macrobdella decora)}
genifyagdvtesnyfripslltlstgtvisaadaryggthdskskiniafakstdggnt
wseptlplkfddyiaknidwprdsvgknvqiqgsasyidpvlledkltkriflfadlmpa
gigssnasvgsgfkevngkkylklrwhkdagraydytirekgviyndatnqptefrvdge
ynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvfkafptnylamrysdde
gaswsdldivssfkpevskflvvgpgigkqistgenagrllvplyskssaelgfmysddh
gdnwtyveadnltggataeaqivempdgslktylrtgsnciaevtsidggetwsdrvplq
gisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwiglvndtgntgidkysv
ewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelhlkdilkfekysiselt
gqa

SCOP Domain Coordinates for d3sli_2:

Click to download the PDB-style file with coordinates for d3sli_2.
(The format of our PDB-style files is described here.)

Timeline for d3sli_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sli_1