Lineage for d5bouc_ (5bou C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936807Domain d5bouc_: 5bou C: [276110]
    Other proteins in same PDB: d5boua_, d5boue_, d5boug_, d5boui_, d5bouj_, d5bouk_, d5boul_, d5boun_, d5bouo_, d5bous_, d5bouu_, d5bouw_, d5boux_, d5bouy_, d5bouz_
    automated match to d1rypd_
    complexed with 4uc, cl, mg

Details for d5bouc_

PDB Entry: 5bou (more details), 2.6 Å

PDB Description: yeast 20s proteasome in complex with a beta1 / beta2 specific non- peptidic sulfonamide ligand
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5bouc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bouc_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5bouc_:

Click to download the PDB-style file with coordinates for d5bouc_.
(The format of our PDB-style files is described here.)

Timeline for d5bouc_: