Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d5bouc_: 5bou C: [276110] Other proteins in same PDB: d5boua_, d5boue_, d5boug_, d5boui_, d5bouj_, d5bouk_, d5boul_, d5boun_, d5bouo_, d5bous_, d5bouu_, d5bouw_, d5boux_, d5bouy_, d5bouz_ automated match to d1rypd_ complexed with 4uc, cl, mg |
PDB Entry: 5bou (more details), 2.6 Å
SCOPe Domain Sequences for d5bouc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bouc_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d5bouc_: