Lineage for d2sli_2 (2sli 277-759)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301738Fold b.68: 6-bladed beta-propeller [50938] (8 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 301739Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 301740Family b.68.1.1: Sialidases (neuraminidases) [50940] (7 proteins)
  6. 301811Protein Leech intramolecular trans-sialidase, C-terminal domain [50948] (1 species)
    contains incomplete beta-barrel subdomain inserted in the second blade
  7. 301812Species North american leech (Macrobdella decora) [TaxId:6405] [50949] (5 PDB entries)
  8. 301813Domain d2sli_2: 2sli 277-759 [27611]
    Other proteins in same PDB: d2sli_1
    complexed with skd

Details for d2sli_2

PDB Entry: 2sli (more details), 1.8 Å

PDB Description: leech intramolecular trans-sialidase complexed with 2,7-anhydro-neu5ac, the reaction product

SCOP Domain Sequences for d2sli_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sli_2 b.68.1.1 (277-759) Leech intramolecular trans-sialidase, C-terminal domain {North american leech (Macrobdella decora)}
genifyagdvtesnyfripslltlstgtvisaadaryggthdskskiniafakstdggnt
wseptlplkfddyiaknidwprdsvgknvqiqgsasyidpvlledkltkriflfadlmpa
gigssnasvgsgfkevngkkylklrwhkdagraydytirekgviyndatnqptefrvdge
ynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvfkafptnylamrysdde
gaswsdldivssfkpevskflvvgpgigkqistgenagrllvplyskssaelgfmysddh
gdnwtyveadnltggataeaqivempdgslktylrtgsnciaevtsidggetwsdrvplq
gisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwiglvndtgntgidkysv
ewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelhlkdilkfekysiselt
gqa

SCOP Domain Coordinates for d2sli_2:

Click to download the PDB-style file with coordinates for d2sli_2.
(The format of our PDB-style files is described here.)

Timeline for d2sli_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2sli_1