Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Elastase [50536] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [50537] (11 PDB entries) |
Domain d5a0ae_: 5a0a E: [276105] automated match to d1ppfe_ complexed with epe, jjs, nag |
PDB Entry: 5a0a (more details), 1.78 Å
SCOPe Domain Sequences for d5a0ae_:
Sequence, based on SEQRES records: (download)
>d5a0ae_ b.47.1.2 (E:) Elastase {Human (Homo sapiens) [TaxId: 9606]} ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl srreptrqvfavqrifengydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn glihgiasfvrggcasglypdafapvaqfvnwidsiiq
>d5a0ae_ b.47.1.2 (E:) Elastase {Human (Homo sapiens) [TaxId: 9606]} ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl srreptrqvfavqrifengydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv qclamgwgllgrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcngl ihgiasfvrggcasglypdafapvaqfvnwidsiiq
Timeline for d5a0ae_: