![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins) automatically mapped to Pfam PF00644 |
![]() | Protein automated matches [227023] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225783] (6 PDB entries) |
![]() | Domain d4zzxb2: 4zzx B:365-583 [276102] Other proteins in same PDB: d4zzxa1, d4zzxb1 automated match to d1gs0a2 complexed with fsu |
PDB Entry: 4zzx (more details), 1.65 Å
SCOPe Domain Sequences for d4zzxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zzxb2 d.166.1.2 (B:365-583) automated matches {Human (Homo sapiens) [TaxId: 9606]} lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm llwhgsrmsnwvgilshglriappeapitgymfgkgiyfadmssksanycfasrlkntgl lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt gilnpdgytlnyneyivynpnqvrmryllkvqfnflqlw
Timeline for d4zzxb2: