Lineage for d1euu_3 (1euu 47-402)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379505Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 379506Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 379507Family b.68.1.1: Sialidases (neuraminidases) [50940] (8 proteins)
  6. 379598Protein Micromonospora sialidase, N-terminal domain [50946] (1 species)
  7. 379599Species Micromonospora viridifaciens [TaxId:1881] [50947] (4 PDB entries)
  8. 379603Domain d1euu_3: 1euu 47-402 [27610]
    Other proteins in same PDB: d1euu_1, d1euu_2
    complexed with gal, na

Details for d1euu_3

PDB Entry: 1euu (more details), 2.5 Å

PDB Description: sialidase or neuraminidase, large 68kd form

SCOP Domain Sequences for d1euu_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euu_3 b.68.1.1 (47-402) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg

SCOP Domain Coordinates for d1euu_3:

Click to download the PDB-style file with coordinates for d1euu_3.
(The format of our PDB-style files is described here.)

Timeline for d1euu_3: